PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01603.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 938aa    MW: 107727 Da    PI: 9.6647
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01603.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.64e-43141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lp+GfrF  tdeel+veyL++kv+g++++l + i+e+d+yk++ w Lp+k+  +ek+wyfF++rd+ky++g+ +n ++ sgyWkat
  Rsa1.0_01603.1_g00007.1  14 LPAGFRFYQTDEELMVEYLCRKVAGHDFSL-QLIAEIDLYKFDAWVLPSKALFGEKDWYFFTPRDRKYPNGSIPNWVAGSGYWKAT 98 
                              799**************************9.89***************8777899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk + + +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Rsa1.0_01603.1_g00007.1  99 GTDKVIST-EGRRVGVKKALVFYVGKAPKGTKTNWIMHEYRL 139
                              ***99999.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-5110149IPR003441NAC domain
PROSITE profilePS5100547.52214170IPR003441NAC domain
PfamPF023651.1E-2115139IPR003441NAC domain
PROSITE profilePS5087816.194229491IPR000477Reverse transcriptase domain
PfamPF000786.7E-43290491IPR000477Reverse transcriptase domain
CDDcd016501.11E-34293491No hitNo description
SuperFamilySSF566726.23E-14298457No hitNo description
PfamPF139668.9E-16753837IPR026960Reverse transcriptase zinc-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 938 aa     Download sequence    Send to blast
MGIQELDPLT QLSLPAGFRF YQTDEELMVE YLCRKVAGHD FSLQLIAEID LYKFDAWVLP  60
SKALFGEKDW YFFTPRDRKY PNGSIPNWVA GSGYWKATGT DKVISTEGRR VGVKKALVFY  120
VGKAPKGTKT NWIMHEYRLI EPSRRNGSTK KQSSAQDLHN SNLVTREYSH NGSSTSSSSH  180
QYEGVLEYKS GFLSLVREPS FDWANSTGHN SAPELGSSHN VPSLRYGDVV AVYTSEEGNK  240
AHQQAEVIPR FNNSGVLSYD QGFSVEPVNG FRHSGQQPSG FGLILLVENL LLATEIVKDY  300
HKDDISPRCA MKIDIAKAFD SVNWSFLLGT LKALHLPDQF IRWIELCVCT PSFSVQVNGE  360
LAEFFQSKRG LRQGCALSPY LFVVCMNVLS HMIDKAAAGN QIGYHPRCKN ILLTHLCFAD  420
DLLVFTDGSK RSIEGVLKIF EKFAMMSGLK ISLEKSTLYT AGISNSQEEG ILARFPFESG  480
KLPVRYLGLP LLTRKMTIND YMPLVEKIKK RMKSWTGRFL SHGGRLQLIN SVITSMANFW  540
LSAFSLPGSC LKEIERLCSA FLWSGPELNT SKAKVNWKDI CLPKQEGGLG IRPLKEINNV  600
LCLKLIWRLF SNRSSLWVSW IHCYLIRKGS FWSVKNNSVA GSWMWKKLLK LRDLAKLFHK  660
MEVNNGKFTS FWYDMWSDLG CLRDYLRDGG SIEMGIKEND LMVEAFRRHR RRRHRIQIFN  720
DVEEEIERIR RSVNQEDDIP LWKQPDNKFS KQFSTKKTWL SLRQPLPECT WSRGIWFPYS  780
TPKYSFHMWL AIKNRLQTMD RILQWNSAVD GVCVLCKDVQ ESCHHLFFSC SYSSKVWREA  840
VGGILKEDFT TQWQEIIEIA SQGRRNSTET FLFRYALQVL THSIWRERNA RKHGEQEVDA  900
RTLAKIVDKM IRLKLLLVKG KGKKYLEESL STWFATRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-9211567173NAC domain-containing protein 19
3swp_C3e-9211567173NAC domain-containing protein 19
3swp_B3e-9211567173NAC domain-containing protein 19
3swp_A3e-9211567173NAC domain-containing protein 19
3swm_D3e-9211567173NAC domain-containing protein 19
3swm_C3e-9211567173NAC domain-containing protein 19
3swm_B3e-9211567173NAC domain-containing protein 19
3swm_A3e-9211567173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701211e-148KJ670121.1 Brassica napus NAC transcription factor 55-1 (NAC55-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674113.10.0PREDICTED: uncharacterized protein LOC106378549
TrEMBLA0A0D3AY020.0A0A0D3AY02_BRAOL; Uncharacterized protein
TrEMBLO810680.0O81068_ARATH; Putative non-LTR retroelement reverse transcriptase
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.11e-137NAC domain containing protein 3